Идет поиск...

Anti-AKR1B1

Кат. №: AV48180
Производитель:
Цена По запросу
Количество
Вы уже добавили максимально доступное на складе кол-во товара
Достигнуто максимально доступное кол-во
Под заказ
{{!!storageProduct ? 'На складе' : 'Под заказ'}}
Ожидается поставка
Description; General description; AKR1B1 codes for a aldo/keto reductase superfamily that catalyzes the reduction of aldehydes. It may functions as PGF synthase in pig endometrium during early pregnancy. AKR1B1 can be induced by proteasome inhibitors in human colon cancer cells. Polymoprhisma in AKR1B1 have been linked to renal insufficiency in type 2 diabetics. Rabbit Anti-AKR1B1 antibody recognizes chicken, canine, rabbit, human, mouse, rat, bovine, pig, and zebrafish AKR1B1.; Immunogen; Synthetic peptide directed towards the C terminal region of human AKR1B1; Application; Rabbit Anti-AKR1B1 antibody is suitable for western blot applications at a concentration of 1.25μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; AKR1B1 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol.This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. There are a few putative pseudogenes for this gene, and one of them has been confirmed and mapped to chromosome 3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.; Sequence; Synthetic peptide located within the following region: QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI
  1. Properties AE-AK Related Categories
Цена по запросу
Sigma-Aldrich
Фасовка: 2 вида
Цена по запросу
Ожидается поставка
Цена по запросу
Sigma-Aldrich
Фасовка: 1 уп.
Цена по запросу
Sigma-Aldrich
Фасовка: 1.0 pak
Цена по запросу
Sigma-Aldrich
Фасовка: 2 вида
Ожидается поставка
Цена по запросу
Sigma-Aldrich
Фасовка: 6 видов
Цена по запросу
Цена по запросу
Цена по запросу
Sisco Research Laboratories
Фасовка: 500 г
Цена по запросу
Sigma-Aldrich
Фасовка: 500 мл
Ожидается поставка
Цена по запросу
Sisco Research Laboratories
Фасовка: 2 вида
Цена по запросу
Sisco Research Laboratories
Фасовка: 2,5 мл
Цена по запросу
Sisco Research Laboratories
Фасовка: 100 г
Цена по запросу
Цена по запросу
Sisco Research Laboratories
Фасовка: 100 мл
Цена по запросу
Цена по запросу
Цена по запросу
Цена по запросу
Цена по запросу
Цена по запросу
Honeywell
Цена по запросу
Цена по запросу
Sigma-Aldrich
Цена по запросу
Sigma-Aldrich
Цена по запросу
Sigma-Aldrich
Цена по запросу
Sigma-Aldrich
Цена по запросу
Sigma-Aldrich
Цена по запросу
Sigma-Aldrich
Цена по запросу
Sigma-Aldrich
Цена по запросу
ABCR
Фасовка: 250 г

Скачать каталог "ХИММЕД" в формате pdf

Химические реактивы - скачать каталог
Химические реактивы
Лабораторное оборудование - скачать каталог
Лабораторное оборудование
Аналитическое оборудование - скачать каталог
Аналитическое оборудование
Биохимия - скачать каталог
Биохимия
Проектирование лабораторий - скачать каталог
Проектирование лабораторий
Материалы для микроэлектроники - скачать каталог
Материалы для микроэлектроники
Для уточнения данных о стоимости и наличии товаров, пожалуйста, обращайтесь к менеджерам по продажам.
Этот сайт использует cookie. Продолжая пользоваться сайтом, вы даёте своё согласие на работу с этими файлами.