Печать
Anti-BRD9
Кат. №: AV34832-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-BRD9
Кат. №: AV34832-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; BRD9 is a bromodomain containing protein that may be involved in transcriptional modulation.
Rabbit Anti-BRD9 recognizes canine, chicken, zebrafish, human, mouse, and rat BRD9.; Immunogen; Synthetic peptide directed towards the N terminal region of human BRD9; Application; Rabbit Anti-BRD9 antibody is suitable for western blot applications at a concentration of 2.5 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; BRD9 encodes a bromodomain containing 9 protein and is located on chromosome 5.; Sequence; Synthetic peptide located within the following region: AIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNR
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
