Anti-EGLN1

Description; General description; EGL-9 family hypoxia-inducible factor 1 (EGLN1) is a protein that catalyzes 4-hydroxyproline formation in hypoxia-inducible factor (HIF) alpha proteins. Studies have reported that EGLN1 reacts with nitric oxide and modulates hypoxic responses. EGLN1 polymorphisms have been linked to high altitude sickness. Rabbit Anti-EGLN1 antibody recognizes canine, human, mouse, rat, and zebrafish EGLN1.; Immunogen; Synthetic peptide directed towards the C terminal region of human EGLN1; Application; Rabbit Anti-EGLN1 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; EGLN1 has a role in the regulation of hypoxia-inducible factor. It is not affected by overexpression or downregulation of HIF-2alpha.; Sequence; Synthetic peptide located within the following region: QPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF