Идет поиск...

Anti-HDAC9

Кат. №: AV42788
Производитель:
Цена По запросу
Количество
Вы уже добавили максимально доступное на складе кол-во товара
Достигнуто максимально доступное кол-во
Под заказ
{{!!storageProduct ? 'На складе' : 'Под заказ'}}
Ожидается поставка
Description; Immunogen; Synthetic peptide directed towards the C terminal region of human HDAC9; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. HDAC9 has sequence homology to members of the histone deacetylase family. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. HDAC9 may play a role in hematopoiesis.Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologous to the Xenopus and mouse MITR genes. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. This encoded protein may play a role in hematopoiesis. Multiple alternatively spliced transcripts have been described for this gene but the full-length nature of some of them has not been determined.; Sequence; Synthetic peptide located within the following region: QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII
  1. Properties Alphabetical Index Related Categories
Цена по запросу
Sigma-Aldrich
Фасовка: 2 вида
Цена по запросу
Ожидается поставка
Цена по запросу
Sigma-Aldrich
Фасовка: 1 уп.
Цена по запросу
Sigma-Aldrich
Фасовка: 1.0 pak
Цена по запросу
Sigma-Aldrich
Фасовка: 2 вида
Ожидается поставка
Цена по запросу
Sigma-Aldrich
Фасовка: 6 видов
Цена по запросу
Цена по запросу
Цена по запросу
Sisco Research Laboratories
Фасовка: 500 г
Цена по запросу
Sigma-Aldrich
Фасовка: 500 мл
Ожидается поставка
Цена по запросу
Sisco Research Laboratories
Фасовка: 2 вида
Цена по запросу
Sisco Research Laboratories
Фасовка: 2,5 мл
Цена по запросу
Sisco Research Laboratories
Фасовка: 100 г
Цена по запросу
Цена по запросу
Sisco Research Laboratories
Фасовка: 100 мл
Цена по запросу
Цена по запросу
Цена по запросу

Скачать каталог "ХИММЕД" в формате pdf

Химические реактивы - скачать каталог
Химические реактивы
Лабораторное оборудование - скачать каталог
Лабораторное оборудование
Аналитическое оборудование - скачать каталог
Аналитическое оборудование
Биохимия - скачать каталог
Биохимия
Проектирование лабораторий - скачать каталог
Проектирование лабораторий
Материалы для микроэлектроники - скачать каталог
Материалы для микроэлектроники
Для уточнения данных о стоимости и наличии товаров, пожалуйста, обращайтесь к менеджерам по продажам.
Этот сайт использует cookie. Продолжая пользоваться сайтом, вы даёте своё согласие на работу с этими файлами.