{{ isErrorSetToBasket === false ? 'Товар добавлен вкорзину' : 'Не удалось добавить товар в корзину'}}
Перейти в корзину
{{Object.keys(error)[0]}}:
{{Object.values(error)[0]}}
Цена По запросу
Количество
Вы уже добавили максимально доступное на складе кол-во товара
Достигнуто максимально доступное кол-во
Под заказ
{{!!storageProduct ? 'На складе' : 'Под заказ'}}
Ожидается поставка
Description; Immunogen; Synthetic peptide directed towards the middle region of human PPIF; Application; Anti-PPIF antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; PPIF (peptidylprolyl isomerase F) also referred to as CypD or cyclophilin F belongs to peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases are highly-conserved cytoplasmic enzymes that accelerate protein folding. PPIF is a part of the mitochondrial permeability transition pore (mPTP) in the inner mitochondrial membrane. Hence, it is anticipated that its association with the mPTP masks the binding site for inhibiting inorganic phosphate (Pi) as well as enhances the open possibility of mPTP that results in apoptosis or necrosis.; Sequence; Synthetic peptide located within the following region: GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS
- Properties Alphabetical Index Related Categories