Идет поиск...

Anti-RAPGEF1

Кат. №: SAB2101945-100UL
Производитель:
Цена По запросу
Количество
Вы уже добавили максимально доступное на складе кол-во товара
Достигнуто максимально доступное кол-во
Под заказ
{{!!storageProduct ? 'На складе' : 'Под заказ'}}
Ожидается поставка
Description_x000D_ Immunogen_x000D_ Synthetic peptide directed towards the C terminal region of human RAPGEF1_x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ RAPGEF1 is a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade protein may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation.This gene encodes a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade that may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: LWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIK
  1. Related Categories Alphabetical Index, Antibodies, Primary Antibodies, RAE-RAX conjugate
Цена по запросу
Sigma-Aldrich
Фасовка: 2 вида
Цена по запросу
Цена по запросу
Цена по запросу
Sigma-Aldrich
Фасовка: 1.0 pak
Цена по запросу
Sigma-Aldrich
Фасовка: 2 вида
Ожидается поставка
Цена по запросу
Sigma-Aldrich
Фасовка: 6 видов
Цена по запросу
Цена по запросу
Цена по запросу
Sisco Research Laboratories
Фасовка: 500 г
Цена по запросу
Sigma-Aldrich
Фасовка: 500 мл
Цена по запросу
Sisco Research Laboratories
Фасовка: 5 г
Цена по запросу
Sisco Research Laboratories
Фасовка: 2,5 мл
Цена по запросу
Sisco Research Laboratories
Фасовка: 100 г
Цена по запросу
Цена по запросу
Sisco Research Laboratories
Фасовка: 100 мл
Цена по запросу
Цена по запросу
Цена по запросу
Цена по запросу
Sisco Research Laboratories
Фасовка: 25 г
Ожидается поставка
Цена по запросу
Sigma-Aldrich
Фасовка: шт

Скачать каталог "ХИММЕД" в формате pdf

Химические реактивы - скачать каталог
Химические реактивы
Лабораторное оборудование - скачать каталог
Лабораторное оборудование
Аналитическое оборудование - скачать каталог
Аналитическое оборудование
Биохимия - скачать каталог
Биохимия
Проектирование лабораторий - скачать каталог
Проектирование лабораторий
Материалы для микроэлектроники - скачать каталог
Материалы для микроэлектроники
Для уточнения данных о стоимости и наличии товаров, пожалуйста, обращайтесь к менеджерам по продажам.
Этот сайт использует cookie. Продолжая пользоваться сайтом, вы даёте своё согласие на работу с этими файлами.