Идет поиск...

Anti-TBP

Кат. №: AV100971-100UL
Производитель:
Цена По запросу
Количество
Вы уже добавили максимально доступное на складе кол-во товара
Достигнуто максимально доступное кол-во
Под заказ
{{!!storageProduct ? 'На складе' : 'Под заказ'}}
Ожидается поставка
Description_x000D_ General description_x000D_ Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes TBP, the TATA-binding protein. A distinctive feature of TBP is a long string of glutamines in the N-terminal. This region of the protein modulates the DNA binding activity of the C terminus, and modulation of DNA binding affects the rate of transcription complex formation and initiation of transcription. Mutations that expand the number of CAG repeats encoding this polyglutamine tract, and thus increase the length of the polyglutamine string, are associated with spinocerebellar ataxia 17, a neurodegenerative disorder classified as a polyglutamine disease._x000D_ Specificity_x000D_ Rabbit polyclonal anti-TBP antibody reacts with chicken, human, mouse, rat, canine, bovine, and zebrafish TATA box binding proteins._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the middle region of human TBP_x000D_ Application_x000D_ Rabbit polyclonal anti-TBP antibody is used to tag TATA box binding protein for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of TATA box binding proteins in RNA transcription by RNA polymerases I, II and III._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: FSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCD
  1. Related Categories Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies for Epigenetics and Nuclear Signaling, Antibodies for Gene Regulation and Expression, Antibodies to Transcription Factors, Antibodies to Transcription Regulators, Primary Antibodies, SP - TF, T-TBMore... conjugate
Цена по запросу
Sigma-Aldrich
Фасовка: 2 вида
Цена по запросу
Ожидается поставка
Цена по запросу
Sigma-Aldrich
Фасовка: 1 уп.
Цена по запросу
Sigma-Aldrich
Фасовка: 1.0 pak
Цена по запросу
Sigma-Aldrich
Фасовка: 2 вида
Ожидается поставка
Цена по запросу
Sigma-Aldrich
Фасовка: 6 видов
Цена по запросу
Цена по запросу
Цена по запросу
Sisco Research Laboratories
Фасовка: 500 г
Цена по запросу
Sigma-Aldrich
Фасовка: 500 мл
Ожидается поставка
Цена по запросу
Sisco Research Laboratories
Фасовка: 2 вида
Цена по запросу
Sisco Research Laboratories
Фасовка: 2,5 мл
Цена по запросу
Sisco Research Laboratories
Фасовка: 100 г
Цена по запросу
Цена по запросу
Sisco Research Laboratories
Фасовка: 100 мл
Цена по запросу
Цена по запросу
Цена по запросу

Скачать каталог "ХИММЕД" в формате pdf

Химические реактивы - скачать каталог
Химические реактивы
Лабораторное оборудование - скачать каталог
Лабораторное оборудование
Аналитическое оборудование - скачать каталог
Аналитическое оборудование
Биохимия - скачать каталог
Биохимия
Проектирование лабораторий - скачать каталог
Проектирование лабораторий
Материалы для микроэлектроники - скачать каталог
Материалы для микроэлектроники
Для уточнения данных о стоимости и наличии товаров, пожалуйста, обращайтесь к менеджерам по продажам.
Этот сайт использует cookie. Продолжая пользоваться сайтом, вы даёте своё согласие на работу с этими файлами.