Anti-TGM2

Description_x000D_ General description_x000D_ TGM2 codes for a transglutaminase that catalyzes the crosslinking of protein via epsilon-gamma glutamyl lysine isopeptide bonds. Tgm2/Gh is known to play a role in the retinoic acid-induced transdifferentiation of mucosal epithelial cells. It functions as a biomarker for predicting treatment efficacy in laryngeal cancer patients undergoing radiotherapy. It is also associated with drug sensitivity in breast cancer._x000D_ Rabbit Anti-TGM2 antibody recognizes human, mouse, rat, and bovineTGM2._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human TGM2_x000D_ Application_x000D_ Rabbit Anti-TGM2 antibody is suitable for western blot applications at a concentration of 0.5 μg/ml._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites and their activity is calcium-dependent. TGM2 acts as a monomer, is induced by retinoic acid, and appears to be involved in apoptosis. Finally, TGM2 is the autoantigen implicated in celiac disease.Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites and their activity is calcium-dependent. The protein encoded by this gene acts as a monomer, is induced by retinoic acid, and appears to be involved in apoptosis. Finally, the encoded protein is the autoantigen implicated in celiac disease. Two transcript variants encoding different isoforms have been found for this gene._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNY