ANTI-VAPB

Description_x000D_ General description_x000D_ The protein encoded by this gene is a type IV membrane protein found in plasma and intracellular vesicle membranes. The encoded protein is found as a homodimer and as a heterodimer with VAPA. This protein also can interact with VAMP1 and VAMP2 and may be involved in vesicle trafficking. (provided by RefSeq)_x000D_ Vesicle-associated membrane protein-associated protein (VAPB) is encoded by the gene mapped to human chromosome 20q13.32. The encoded protein is characterized with a major sperm protein (MSP) domain and amphipathic helical structure, which might form coiled/coil protein-protein interaction motif and a hydrophobic C- terminus. VAPB is ubiquitously expressed and is localized to the intracellular membranes, such as endoplasmic reticulum (ER) and the Golgi apparatus._x000D_ Immunogen_x000D_ VAPB (AAH01712, 1 a.a. ~ 243 a.a) full-length human protein._x000D_ Sequence_x000D_ MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Biochem/physiol Actions_x000D_ Vesicle-associated membrane protein-associated protein (VAPB) facilitates endoplasmic reticulum (ER)-Golgi transport and secretion. In addition, it is also involved in various processes, such as ER stress and the unfolded protein response (UPR) and bouton formation at the neuromuscular junction. VAPB acts along with protein tyrosine phosphatase-interacting protein 51 (PTPIP51) to regulate calcium homeostasis. Mutation in the gene is associated with development of various disorders, such as amyotrophic lateral sclerosis 8 (ALS8), late-onset spinal muscular atrophy finkel type.