Перейти к контенту
Main image
Печать
MONOCLONAL ANTI-EMP3
Кат. №: WH0002014M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
MONOCLONAL ANTI-EMP3
Main image
Кат. №: WH0002014M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
MONOCLONAL ANTI-EMP3
Кат. №: WH0002014M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ Epithelial membrane protein-3 (EMP3) belongs to the belongs to the peripheral myelin protein 22 kDa (PMP22) gene family of small hydrophobic membrane glycoproteins. This gene is located on human chromosome 19q13.3. EMP3 codes for a 163 amino-acid protein that has four transmembrane domains._x000D_ Immunogen_x000D_ EMP3 (AAH09718, 1 a.a. ~ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ Epithelial membrane protein 3 (EMP3) is a trans-membrane signaling molecule that controls apoptosis, differentiation and invasion of cancer cells. This gene may be considered as a tumor suppressor gene in glioma, neuroblastoma, esophageal squamous cell carcinoma (ESCC) cell lines and non-small cell lung cancer (NSCLC).
Related Categories
Alphabetical Index, Antibodies, EJ-EN, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ Epithelial membrane protein-3 (EMP3) belongs to the belongs to the peripheral myelin protein 22 kDa (PMP22) gene family of small hydrophobic membrane glycoproteins. This gene is located on human chromosome 19q13.3. EMP3 codes for a 163 amino-acid protein that has four transmembrane domains._x000D_ Immunogen_x000D_ EMP3 (AAH09718, 1 a.a. ~ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ Epithelial membrane protein 3 (EMP3) is a trans-membrane signaling molecule that controls apoptosis, differentiation and invasion of cancer cells. This gene may be considered as a tumor suppressor gene in glioma, neuroblastoma, esophageal squamous cell carcinoma (ESCC) cell lines and non-small cell lung cancer (NSCLC).
Related Categories
Alphabetical Index, Antibodies, EJ-EN, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.