Description_x000D_ General description_x000D_ This gene is a member of the protocadherin family, which represents a subset of the larger cadherin superfamily. The members of the protocadherin family encode non-classical cadherins that function as calcium-dependent cell-cell adhesion molecules. The kidney-expressed gene product has a signal peptide, nine cadherin repeat domains and a unique cytoplasmic region. This protocadherin represents a new candidate for tumor suppression. (provided by RefSeq)_x000D_ Immunogen_x000D_ PCLKC (NP_060145, 210 a.a. ~ 318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ GGMYHNTFTIQCSLPVFLSISVVDQPDLDPQFVREFYSASVAEDAAKGTSVLTVEAVDGDKGINDPVIYSISYSTRPGWFDIGADGVIRVNGSLDREQLLEADEEVQLQ_x000D_ Application_x000D_ Monoclonal Anti-PCLKC antibody produced in mouse has been used in dual immunostaining._x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ CDHR2 (cadherin-related family member 2), also known as protocadherin-LKC, consists of seven cadherin motifs or EC domain with negatively charged Ca2+ dependent homophilic-binding domains. It is mainly involved in the maintenance of cell-tissue morphology and polarity. It has been reported that the expression of CDHR2 actuates cell aggregation capacity, followed by direct cell-cell interaction. CDHR2 has additionally been documented as a potential tumor silencer gene for the colon and liver malignancies.