Перейти к контенту
Main image
Печать
Anti-ALG11
Кат. №: AV44463-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-ALG11
Main image
Кат. №: AV44463-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-ALG11
Кат. №: AV44463-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; Asparagine-linked glycosylation 11 homolog (ALG11), GDP-Man:Man3GlcNAc2-PP-dolichol-α1,2-mannosyltransferase, is a mannosyltransferase which catalyzes α 1,2-mannosylations of N-linked glycans during protein glycosylation within the endoplasmic reticulum (ER).; Specificity; Anti-ALG11 antibody reacts with zebrafish, canine, human, mouse, rat, bovine, and chicken asparagine-linked glycosylation 11 homolog (ALG11p).; Immunogen; Synthetic peptide directed towards the C terminal region of human ALG11; Application; Anti-ALG11 antibody is used to tag asparagine-linked glycosylation 11 homolog proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of this mannosyltransferase in disorders such as congenital disorder of glycosylation-Ip.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Sequence; Synthetic peptide located within the following region: LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES
Properties
AL-AL Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; General description; Asparagine-linked glycosylation 11 homolog (ALG11), GDP-Man:Man3GlcNAc2-PP-dolichol-α1,2-mannosyltransferase, is a mannosyltransferase which catalyzes α 1,2-mannosylations of N-linked glycans during protein glycosylation within the endoplasmic reticulum (ER).; Specificity; Anti-ALG11 antibody reacts with zebrafish, canine, human, mouse, rat, bovine, and chicken asparagine-linked glycosylation 11 homolog (ALG11p).; Immunogen; Synthetic peptide directed towards the C terminal region of human ALG11; Application; Anti-ALG11 antibody is used to tag asparagine-linked glycosylation 11 homolog proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of this mannosyltransferase in disorders such as congenital disorder of glycosylation-Ip.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Sequence; Synthetic peptide located within the following region: LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES
Properties
AL-AL Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.