Description_x000D_ Immunogen_x000D_ Synthetic peptide directed towards the C terminal region of human ASB5_x000D_ Application_x000D_ Anti-ASB5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ Ankyrin repeat and SOCS box containing 5 (ASB5) belongs to the ankyrin repeat and SOCS box-containing (ASB) family of proteins. These proteins regulate protein turnover by targeting proteins for polyubiquitination and proteasome-mediated degradation. It is expressed in endothelial cells and smooth muscle cells and is involved in arteriogenesis._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC