Description_x000D_ General description_x000D_ B-cell lymphoma 2 associated X (BAX), also known as CLECSF10 (C-type lectin superfamily member 10), is located on human chromosome 19q13. BAX is a proapoptotic protein and is a member of Bcl-2 protein family._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human BAX_x000D_ Application_x000D_ Anti-BAX has been used in Western blotting._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ B-cell lymphoma 2 associated X (BAX) promotes cell death and plays a vital role in regulation of apoptosis. BAX gene may act as a negative regulator of autophagy in CRC (colorectal cancer) development._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPV