Description; Immunogen; Synthetic peptide directed towards the N terminal region of human CEBPG; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; CCAAT/enhancer binding protein (C/EBP), γ (CEBPG) is a transcription factor that regulates transcription mediated by CCAAT/enhancer element. CEBPG mediates wound repair and cell migration by affecting the EGFR-mediated signaling. It has been reported to be deregulated in acute myeloid leukemia resulting in differentiation arrest.; Sequence; Synthetic peptide located within the following region: PGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDR