Anti-CLIC2

Description; General description; CLIC2 codes for an intracellular chloride ion channel protein. CLIC2 forms pH-dependent chloride channels in in vitro conditions. Its chloride channel functions are modulated by pH levels and redox status. It interacts with skeletal ryanodine receptor (RyR1). Rabbit Anti-CLIC2 antibody recognizes chicken, mouse, rat, rabbit, human, bovine, and canine CLIC2.; Immunogen; Synthetic peptide directed towards the C terminal region of human CLIC2; Application; Rabbit Anti-CLIC2 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Chloride intracellular channel 2 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel 2 encodes a protein that is detected in fetal liver and adult skeletal muscle tissue. CLIon Channel2 maps to the candidate region on chromosome X for incontinentia pigmenti.; Sequence; Synthetic peptide located within the following region: SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG