Anti-ELF2

Description; General description; ELF2 is a transcription factor that belongs to the Eph ligand family of proteins. This transcription factor is known to be expressed in the hind brain and newly forming somites of the mouse embryo. Rabbit Anti-ELF2 antibody recognizes chicken, human, mouse, rat, and canine ELF2.; Immunogen; Synthetic peptide directed towards the N terminal region of human ELF2; Application; Rabbit Anti-ELF2 antibody can be used for western blot assays at concentration of 0.5μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; The ELF2 gene encodes a protein that physically interacts with AML1 and mediates opposing effects on AML1-mediated transcription of the B cell-specific blk gene.; Sequence; Synthetic peptide located within the following region: TSPDSHEPMKKKKVGRKPKTQQSPISNGSPELGIKKKPREGKGNTTYLWE