Печать
Anti-FOXE3
Кат. №: AV32304
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-FOXE3
Кат. №: AV32304
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; FOXE3 is a forkhead transcription factor that regulates the development of lens in vertebrates. Studies in mice have reported that lack of FoxE3 can lead to defects in the growth and differentiation of lens cells. FOXE3 mutations have also been linked to ocular dysgenesis and cataract.
Rabbit Anti-FOXE3 antibody recognizes human FOXE3.; Immunogen; Synthetic peptide directed towards the C terminal region of human FOXE3; Application; Rabbit Anti-FOXE3 antibody can be used for western blot (4-8μg/ml) and IHC (4-8μg/ml, using paraffin-embedded tissues) applications.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Forkhead Box Protein E3 (FOXE3, forkhead-related protein FKHL12, forkhead-related transcription factor 8) is a forkhead/winged helix transcription factor, which is expressed in the developing lens from the start of lens placode induction and becomes restricted to the anterior proliferating cells when lens fiber differentiation begins.; Sequence; Synthetic peptide located within the following region: PEPPCCAAPDAAAAAFPPCAAAASPPLYSQVPDRLVLPATRPGPGPLPAE
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
