Перейти к контенту
Main image
Печать
Anti-GLI1
Кат. №: AV100609
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-GLI1
Main image
Кат. №: AV100609
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-GLI1
Кат. №: AV100609
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; Immunogen; Synthetic peptide directed towards the N terminal region of human GLI1; Application; Anti-GLI1 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; GLI1 is a family of zinc finger transcription factors that mediate the effects of Hedgehog pathway. The activation of GLI1 is the effect of the binding of Shh ligand to receptor PTCH. GLI1 has been observed to be overexpressed in glioblastoma and induces the genes involved in tumor development and progression.; Sequence; Synthetic peptide located within the following region: LRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGPARETNSCTEGPLF
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; Immunogen; Synthetic peptide directed towards the N terminal region of human GLI1; Application; Anti-GLI1 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; GLI1 is a family of zinc finger transcription factors that mediate the effects of Hedgehog pathway. The activation of GLI1 is the effect of the binding of Shh ligand to receptor PTCH. GLI1 has been observed to be overexpressed in glioblastoma and induces the genes involved in tumor development and progression.; Sequence; Synthetic peptide located within the following region: LRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGPARETNSCTEGPLF
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.