{{ isErrorSetToBasket === false ? 'Товар добавлен вкорзину' : 'Не удалось добавить товар в корзину'}}
Перейти в корзину
{{Object.keys(error)[0]}}:
{{Object.values(error)[0]}}
Цена По запросу
Количество
Вы уже добавили максимально доступное на складе кол-во товара
Достигнуто максимально доступное кол-во
Под заказ
{{!!storageProduct ? 'На складе' : 'Под заказ'}}
Ожидается поставка
Description_x000D_
General description_x000D_
This gene encodes a conserved homeobox protein that is a transcriptional repressor in the developing forebrain and pituitary gland. Mutations in this gene are associated with septooptic dysplasia, HESX1-related growth hormone deficiency, and combined pituitary hormone deficiency. (provided by RefSeq)_x000D_
Immunogen_x000D_
HESX1 (NP_003856.1, 1 a.a. ~ 185 a.a) full-length human protein._x000D_
Sequence_x000D_
MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE_x000D_
Physical form_x000D_
Solution in phosphate buffered saline, pH 7.4
- Related Categories Alphabetical Index, Antibodies, H1-HE, Primary Antibodies conjugate