Перейти к контенту
Main image
Печать
Anti-ISL2
Кат. №: AV37377
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-ISL2
Main image
Кат. №: AV37377
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-ISL2
Кат. №: AV37377
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; Insulin gene enhancer protein, ISL-2, is a LIM homeobox domain transcription factor. Human ISL-2 is a 39 kDa protein found expressed in the nucleus of numerous cell types including motorneurons early in development of the spinal column.; Immunogen; Synthetic peptide directed towards the C terminal region of mouse ISL2; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Isl2 specifies RGC laterality by repressing an ipsilateral pathfinding program unique to VTC RGCs and involving Zic2 and EphB1. This genetic hierarchy controls binocular vision.; Sequence; Synthetic peptide located within the following region: VIRVWFQNKRCKDKKKSILMKQLQQQQHSDKASFQGLTGTPLVAGSPIGH
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; General description; Insulin gene enhancer protein, ISL-2, is a LIM homeobox domain transcription factor. Human ISL-2 is a 39 kDa protein found expressed in the nucleus of numerous cell types including motorneurons early in development of the spinal column.; Immunogen; Synthetic peptide directed towards the C terminal region of mouse ISL2; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Isl2 specifies RGC laterality by repressing an ipsilateral pathfinding program unique to VTC RGCs and involving Zic2 and EphB1. This genetic hierarchy controls binocular vision.; Sequence; Synthetic peptide located within the following region: VIRVWFQNKRCKDKKKSILMKQLQQQQHSDKASFQGLTGTPLVAGSPIGH
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.