Перейти к контенту
Main image
Печать
Anti-KCNK3
Кат. №: AV35090-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-KCNK3
Main image
Кат. №: AV35090-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-KCNK3
Кат. №: AV35090-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; KCNK3 (TASK1) is a potassium channel protein that contains pore-forming domains. ML365 is known to selectively inhibit KCNK3. It is involved in the chemosensory regulation of breathing. KCNK3 variations have been linked to BP and aldosterone production. Rabbit Anti-KCNK3 antibody recognizes human, mouse, rat, bovine, canine, and rabbit KCNK3.; Immunogen; Synthetic peptide directed towards the C terminal region of human KCNK3; Application; Rabbit Anti-KCNK3 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; KCNK3 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The gene product is an outwardly rectifying channel that is sensitive to changes in extracellular pH and is inhibited by extracellular acidification. Also referred to as an acid-sensitive potassium channel, it is activated by the anesthetics halothane and isoflurane. Although three transcripts are detected in northern blots, there is currently no sequence available to confirm transcript variants for this gene.; Sequence; Synthetic peptide located within the following region: TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; General description; KCNK3 (TASK1) is a potassium channel protein that contains pore-forming domains. ML365 is known to selectively inhibit KCNK3. It is involved in the chemosensory regulation of breathing. KCNK3 variations have been linked to BP and aldosterone production. Rabbit Anti-KCNK3 antibody recognizes human, mouse, rat, bovine, canine, and rabbit KCNK3.; Immunogen; Synthetic peptide directed towards the C terminal region of human KCNK3; Application; Rabbit Anti-KCNK3 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; KCNK3 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The gene product is an outwardly rectifying channel that is sensitive to changes in extracellular pH and is inhibited by extracellular acidification. Also referred to as an acid-sensitive potassium channel, it is activated by the anesthetics halothane and isoflurane. Although three transcripts are detected in northern blots, there is currently no sequence available to confirm transcript variants for this gene.; Sequence; Synthetic peptide located within the following region: TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.