Идет поиск...

ANTI-KIAA0319

Кат. №: HPA076313-100UL
Производитель:
Цена По запросу
Количество
Вы уже добавили максимально доступное на складе кол-во товара
Достигнуто максимально доступное кол-во
Под заказ
{{!!storageProduct ? 'На складе' : 'Под заказ'}}
Ожидается поставка
Description_x000D_ Immunogen_x000D_ Recombinant protein corresponding to KIAA0319_x000D_ Sequence_x000D_ KTKYTILDNMDEQERMELRPKYGIKHRSTEHNSSLMVSESEFDSDQDTIFSREKMERGNPKVSMNGSIRNGASFSYCSKD_x000D_ Application_x000D_ All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry._x000D_ The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige._x000D_ Physical form_x000D_ 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Legal Information_x000D_ Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC_x000D_ Features and Benefits_x000D_ Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section._x000D_ Every Prestige Antibody is tested in the following ways:_x000D_ • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues._x000D_ • Protein array of 364 human recombinant protein fragments._x000D_ • Validated for multiple commonly used applications such as IHC (Immunohistochemistry), IF (Immunofluorescence), and WB (Western Blot)
  1. Related Categories Alphabetical Index, Antibodies, K, KIA-KIT, Prestige Antibodies, Prestige Polyclonal Antibodies, Primary AntibodiesMore... product line
Цена по запросу
Sigma-Aldrich
Фасовка: 2 вида
Цена по запросу
Цена по запросу
Цена по запросу
Sigma-Aldrich
Фасовка: 1.0 pak
Цена по запросу
Sigma-Aldrich
Фасовка: 2 вида
Ожидается поставка
Цена по запросу
Sigma-Aldrich
Фасовка: 6 видов
Цена по запросу
Цена по запросу
Цена по запросу
Sisco Research Laboratories
Фасовка: 500 г
Цена по запросу
Sigma-Aldrich
Фасовка: 500 мл
Ожидается поставка
Цена по запросу
Sisco Research Laboratories
Фасовка: 2 вида
Цена по запросу
Sisco Research Laboratories
Фасовка: 2,5 мл
Цена по запросу
Sisco Research Laboratories
Фасовка: 100 г
Цена по запросу
Цена по запросу
Sisco Research Laboratories
Фасовка: 100 мл
Цена по запросу
Цена по запросу
Цена по запросу

Скачать каталог "ХИММЕД" в формате pdf

Химические реактивы - скачать каталог
Химические реактивы
Лабораторное оборудование - скачать каталог
Лабораторное оборудование
Аналитическое оборудование - скачать каталог
Аналитическое оборудование
Биохимия - скачать каталог
Биохимия
Проектирование лабораторий - скачать каталог
Проектирование лабораторий
Материалы для микроэлектроники - скачать каталог
Материалы для микроэлектроники
Для уточнения данных о стоимости и наличии товаров, пожалуйста, обращайтесь к менеджерам по продажам.
Этот сайт использует cookie. Продолжая пользоваться сайтом, вы даёте своё согласие на работу с этими файлами.