Anti-LPIN1

Description; Immunogen; Synthetic peptide directed towards the N terminal region of human LPIN1; Application; Anti-LPIN1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; LPIN1 (lipin 1) encodes a magnesium-ion-dependent phosphatidic acid phosphohydrolase enzyme that catalyzes the dephosphorylation of phosphatidic acid to form diacylglycerol. It is a transcriptional co-regulator that regulates lipid metabolism and adipogenesis (adipocyte maturation and maintenance) by modulating the C/EBPα (CCAAT/enhancer-binding protein α) and PPAR γ (peroxisome-proliferator-activated receptor γ) network. Lipin 1 also plays a pivotal role in controlling autophagy clearance by facilitating the maturation of autolysosomes via stimulation of protein kinase D (PKD)-Vps34 phosphatidylinositol 3-kinase signaling cascade.; Sequence; Synthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK