Перейти к контенту
Main image
Печать
Anti-MLLT3
Кат. №: AV38489
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-MLLT3
Main image
Кат. №: AV38489
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-MLLT3
Кат. №: AV38489
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human MLLT3_x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ MLLT3 is a regulator of early erythroid and megakaryocytic cell fate in the human system. Expression of MLLT3 in human CD34+ cells induces acute myeloid, lymphoid, or mixed-lineage leukemia in immunodeficient mice. Translocation t (9;11)(p22;q23), a chromosomal aberration involving MLLT3 is associated with acute leukemias._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEK
Related Categories
Alphabetical Index, Antibodies, MF-MN, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human MLLT3_x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ MLLT3 is a regulator of early erythroid and megakaryocytic cell fate in the human system. Expression of MLLT3 in human CD34+ cells induces acute myeloid, lymphoid, or mixed-lineage leukemia in immunodeficient mice. Translocation t (9;11)(p22;q23), a chromosomal aberration involving MLLT3 is associated with acute leukemias._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEK
Related Categories
Alphabetical Index, Antibodies, MF-MN, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.