{{ isErrorSetToBasket === false ? 'Товар добавлен вкорзину' : 'Не удалось добавить товар в корзину'}}
Перейти в корзину
{{Object.keys(error)[0]}}:
{{Object.values(error)[0]}}
Цена По запросу
Количество
Вы уже добавили максимально доступное на складе кол-во товара
Достигнуто максимально доступное кол-во
Под заказ
{{!!storageProduct ? 'На складе' : 'Под заказ'}}
Ожидается поставка
Description; General description; OCIAD1 codes for an OCIA domain-containing protein that is involved in ovarian cancer cell adhesion. Its expression in differentiated thyroid carcinoma has been correlated to metastasis risk.
Rabbit Anti-OCIAD1 antibody recognizes canine, bovine, human, mouse, and rat OCIAD1.; Immunogen; Synthetic peptide directed towards the C terminal region of human OCIAD1; Application; Rabbit Anti-OCIAD1 antibody is suitable for western blot applications at a concentration of 1μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; OCIAD1 belongs to the OCIAD1 family. It contains 1 OCIA domain. OCIAD1 is over-expressed in metastatic ovarian cancer. Effect of OCIAD1 on cell adhesion may be related to its function in ovarian cancer. Possibily, OCIAD1 may play a role in tumor metastasis.; Sequence; Synthetic peptide located within the following region: QGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPK
- Properties Alphabetical Index Related Categories
