Description; Immunogen; Synthetic peptide directed towards the N terminal region of human PCDHA4; Application; Anti-PCDHA4 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Protocadherin alpha 4 (PCDHA4) is an integral plasma membrane protein that is crucial for the formation and function of cell-to-cell connections in the brain.; Sequence; Synthetic peptide located within the following region: VDRPLQVFHVDVEVRDINDNPPVFPATQKNLSIAESRPLDSRFPLEGASD