Anti-PIK3CB

Description_x000D_ General description_x000D_ PIK3CB is a component of the PI3K signaling pathway that functions downstream of the EGFR pathway. Studies have reported that PTEN-deficient cancers are dependent on PIK3CB. Furthermore, PI3KCB downregulation can suppress cell growth in malignant gliomas._x000D_ Rabbit Anti-PIK3CB antibody recognizes bovine, canine, human, mouse, rat, zebrafish, and chicken PIK3CB._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the C terminal region of human PIK3CB_x000D_ Application_x000D_ Rabbit Anti-PIK3CB antibody can be used for western blot applications at a concentration of 5μg/ml._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110-kD catalytic subunit, such as PIK3CB, and an 85-kD adaptor subunit (Hu et al., 1993).[supplied by OMIM]._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD