ANTI-PTH

Description_x000D_ General description_x000D_ The protein encoded by this gene is a hormone secreted by parathyroid cells. This hormone elevates blood Ca2+ level by dissolving the salts in bone and preventing their renal excretion. Defects in this gene are a cause of familial isolated hypoparathyroidism (FIH). (provided by RefSeq)_x000D_ Immunogen_x000D_ PTH (NP_000306.1, 1 a.a. ~ 115 a.a) full-length human protein._x000D_ Sequence_x000D_ MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ PTH (parathyroid hormone) is an important regulatory hormone for calcium homeostasis. In chronic kidney disease, hyperparathyroidism caused due to increased levels of PTH leads to arteriosclerotic fibrosis and calcification. Elevation in the levels of PTH might be associated with hypertension, bone disease and also in few cases it results in death due to cardiovascular disease. PTH is known to induce the secretion of aldosterone hormone in adrenocortex.