Печать
Anti-RORC
Кат. №: AV45622
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-RORC
Кат. №: AV45622
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; Immunogen; Synthetic peptide directed towards the N terminal region of human RORC; Application; Anti-RORC (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Retinoic acid related orphan receptor C (RORC), a member of the retinoid-related orphan family of nuclear receptors, is a ligand-dependent transcription factor. RORs have important roles in development, immunity and maintenance of circadian rhythm and metabolism. RORC may be involved in lymphoid organogenesis and thymopoiesis.; Sequence; Synthetic peptide located within the following region: EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
