Anti-SALF

Description_x000D_ General description_x000D_ Rabbit polyclonal anti-SALF antibody reacts with human, mouse, zebrafish, canine, bovine, and rat stoning-1 clathrin adaptor factors._x000D_ Stonins are evolutionarily conserved, clathrin adaptor complex (AP-2mu-related) factors. They may function as cargo-specific sorting adaptors during cellular endocytosis. Stonin 1 (STON1 or SALF) is the human homolog of the Drosophila protein, stoned B._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the C terminal region of human SALF_x000D_ Application_x000D_ Rabbit Anti-SALF antibody can be used for western blot application at a concentration of 5μg/ml._x000D_ Rabbit polyclonal anti-SALF antibody is used to tag stonin-1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of stonin-1 in processes related to cargo-specific sorting in endocytosis._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ The SALF mRNA is an infrequent but naturally occurring co-transcribed product of the neighboring SBLF and ALF genes. This rare transcript encodes a fusion protein composed of greater than 95% each of the individual elements, stoned B-like factor (SBLF) and TFIIA-alpha/beta-like factor (ALF). The significance of this co-transcribed mRNA and the function of its protein product have not yet been determined._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: NSGDDVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRD