ANTI-TDO2

Description_x000D_ General description_x000D_ Tryptophan 2,3-dioxygenase (EC 1.13.11.11) plays a role in catalyzing the first and rat-limiting step in the kynurenine pathway, the major pathway of tryptophan metabolism.[supplied by OMIM_x000D_ Immunogen_x000D_ TDO2 (NP_005642.1, 1 a.a. ~ 406 a.a) full-length human protein._x000D_ Sequence_x000D_ MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ TDO2 (tryptophan 2, 3-dioxygenase) is responsible for the cleavage of indole ring at the C2-C3 bond of L-tryptophan, thereby regulating tryptophan concentration. It is expressed in tumor cells and suppresses antitumor immune responses. During acute ethanol intake, TDO2 carries the kynurenine pathway via glucocorticoid-associated route. This can lead to the accumulation of neurotoxic metabolites along with the reduction of serotonin. The TDO2 gene is upregulated in brains of patients with Alzheimer′s disease and might be associated with making of neurofibrillary tangles and senile plaque. TDO2 is also responsible for antimicrobial and immunoregulatory activities.