Перейти к контенту
Main image
Печать
Anti-ZNF258
Кат. №: AV34839-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-ZNF258
Main image
Кат. №: AV34839-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-ZNF258
Кат. №: AV34839-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; ZNF258 (ZMYM6) codes for a zinc finger protein that contains the zinc-binding motif, MYM. Rabbit Anti-ZNF258 antibody recognizes human and canine ZNF258.; Immunogen; Synthetic peptide directed towards the middle region of human ZNF258; Application; Rabbit Anti-ZNF258 antibody is suitable for western blot applications at a concentration of 0.5 μg/ml and IHC assays at 4-8 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; ZNF258 is part of a novel, putative, zinc-binding motif (MYM) family which encodes proteins that maintain the repeats of the MYM motif.; Sequence; Synthetic peptide located within the following region: TPVITSVMSLAKIPATLSTGNTNSVLKGAVTKEAAKIIQDESTQEDAMKF
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; General description; ZNF258 (ZMYM6) codes for a zinc finger protein that contains the zinc-binding motif, MYM. Rabbit Anti-ZNF258 antibody recognizes human and canine ZNF258.; Immunogen; Synthetic peptide directed towards the middle region of human ZNF258; Application; Rabbit Anti-ZNF258 antibody is suitable for western blot applications at a concentration of 0.5 μg/ml and IHC assays at 4-8 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; ZNF258 is part of a novel, putative, zinc-binding motif (MYM) family which encodes proteins that maintain the repeats of the MYM motif.; Sequence; Synthetic peptide located within the following region: TPVITSVMSLAKIPATLSTGNTNSVLKGAVTKEAAKIIQDESTQEDAMKF
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.