{{ isErrorSetToBasket === false ? 'Товар добавлен вкорзину' : 'Не удалось добавить товар в корзину'}}
Перейти в корзину
{{Object.keys(error)[0]}}:
{{Object.values(error)[0]}}
Цена По запросу
Количество
Вы уже добавили максимально доступное на складе кол-во товара
Достигнуто максимально доступное кол-во
Под заказ
{{!!storageProduct ? 'На складе' : 'Под заказ'}}
Ожидается поставка
Description_x000D_
General description_x000D_
This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein functions as a monomer, exporting copper out of the cells, such as the efflux of hepatic copper into the bile. Alternate transcriptional splice variants, encoding different isoforms with distinct cellular localizations, have been characterized. Mutations in this gene have been associated with Wilson disease (WD). (provided by RefSeq)_x000D_
Immunogen_x000D_
ATP7B (NP_000044, 1372 a.a. ~ 1465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_
Sequence_x000D_
QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI_x000D_
Physical form_x000D_
Solution in phosphate buffered saline, pH 7.4_x000D_
Disclaimer_x000D_
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- Related Categories ATH-AZ, Alphabetical Index, Antibodies, Primary Antibodies conjugate