Description_x000D_ General description_x000D_ LIM proteins are defined by the possession of a highly conserved double zinc finger motif called the LIM domain.[supplied by OMIM_x000D_ Immunogen_x000D_ FHL3 (NP_004459.2, 3 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ ESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCS_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4