{{ isErrorSetToBasket === false ? 'Товар добавлен вкорзину' : 'Не удалось добавить товар в корзину'}}
Перейти в корзину
{{Object.keys(error)[0]}}:
{{Object.values(error)[0]}}
Цена По запросу
Количество
Вы уже добавили максимально доступное на складе кол-во товара
Достигнуто максимально доступное кол-во
Под заказ
{{!!storageProduct ? 'На складе' : 'Под заказ'}}
Ожидается поставка
Description_x000D_
General description_x000D_
The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM_x000D_
Immunogen_x000D_
FIS1 (AAH03540.1, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_
Sequence_x000D_
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS_x000D_
Physical form_x000D_
Clear solution_x000D_
Disclaimer_x000D_
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- Related Categories Alphabetical Index, Antibodies, FB-FJ, Primary Antibodies conjugate