Description_x000D_ General description_x000D_ This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. The encoded protein plays a role in neurofilament architecture and is involved in mediating the ubiquitination and degradation of some proteins. Defects in this gene are a cause of giant axonal neuropathy (GAN). (provided by RefSeq)_x000D_ Immunogen_x000D_ GAN (NP_071324, 534 a.a. ~ 597 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ DLDTGTNYDYVREFKRSTGTWHHTKPLLPSDLRRTGCAALRIANCKLFRLQLQQGLFRIRVHSP_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4