{{ isErrorSetToBasket === false ? 'Товар добавлен вкорзину' : 'Не удалось добавить товар в корзину'}}
Перейти в корзину
{{Object.keys(error)[0]}}:
{{Object.values(error)[0]}}
Цена По запросу
Количество
Вы уже добавили максимально доступное на складе кол-во товара
Достигнуто максимально доступное кол-во
Под заказ
{{!!storageProduct ? 'На складе' : 'Под заказ'}}
Ожидается поставка
Description_x000D_
General description_x000D_
This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. (provided by RefSeq)_x000D_
Immunogen_x000D_
RIPK2 (AAH04553, 431 a.a. ~ 540 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_
Sequence_x000D_
LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM_x000D_
Physical form_x000D_
Solution in phosphate buffered saline, pH 7.4_x000D_
Disclaimer_x000D_
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_
Legal Information_x000D_
GenBank is a registered trademark of United States Department of Health and Human Services
- Related Categories Alphabetical Index, Antibodies, Antibodies for Apoptosis, Antibodies for Cell Biology, Antibodies for Kinase/Phosphatase Biology, Antibodies to Other Apoptosis-related Proteins, Primary Antibodies, RH-RN, Receptor-Interacting Protein (RIP)-Like Interacting Caspase-Like Apoptosis Regulatory Protein Kinase (RICK), Serine/Threonine Kinase AntibodiesMore... conjugate