Description_x000D_ General description_x000D_ Glutamate and aspartate are excitatory neurotransmitters that have been implicated in a number of pathologic states of the nervous system. Accumulation of extracellular excitatory amino acids can be cytotoxic and may also lower the seizure threshold in epilepsy. EAAT1 (SLC1A3) is a member of a family of high-affinity sodium-dependent transporter molecules that regulate neurotransmitter concentrations at the excitatory glutamatergic synapses of the mammalian central nervous system (Kirschner et al., 1994 [PubMed 8001975]).[supplied by OMIM_x000D_ The gene encoding solute carrier family 1 member 3 (SLC1A3), also known as excitatory amino acid transporter 1 (EAAT1), is localized on human chromosome 5p13.2._x000D_ Immunogen_x000D_ SLC1A3 (NP_004163.2, 162 a.a. ~ 237 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ VRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGS_x000D_ Physical form_x000D_ Clear solution_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ Solute carrier family 1 member 3 (SLC1A3) is a glial glutamate transporter. It acts as a modulator of glutamate-mediated signals by clearing glutamate after synaptic release. Additionally, it possesses an anion channel activity that inhibits additional glutamate release. The protein also has a role in active and passive water transport. Mutations in the gene encoding SLC1A3 have been linked to episodic ataxia type 6 (EA6).