MONOCLONAL ANTI-SREBF1

Description_x000D_ General description_x000D_ Sterol regulatory element binding transcription factor 1 (SREBF1) gene is located on human chromosome 17p11.2. SREBF1 encodes the transcription factors SREBP-1a and SREBP-1c. SREBP-1a is expressed in spleen and intestine.SREBP-1c is expressed in liver, adipose tissue and skeletal muscle._x000D_ Immunogen_x000D_ SREBF1 (AAH57388, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ Sterol regulatory element binding transcription factor 1 (SREBF1) regulates lipogenesis, energy homeostasis and insulin sensitivity. It is associated with non-alcoholic fatty liver disease (NAFLD). SREBF1 promotes tumor growth in various cancers. SREBF1 acts as a molecular bridge between lipogenesis and cell cycle control clear cell renal carcinoma.