MONOCLONAL ANTI-WARS

Description_x000D_ General description_x000D_ Tryptophanyl-tRNA synthetase, cytoplasmic (WARS) or IFP53 is the cytoplasmic form of tryptophanyl-tRNA synthetase. It is induced by interferons and the gene encoding it is localized on human chromosome 14q32.31._x000D_ Immunogen_x000D_ WARS (NP_004175, 50 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ YKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDA_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ Tryptophanyl-tRNA synthetase, cytoplasmic (WARS) is involved in the tryptophan aminoacylation of tRNAtrp. Mutations in the gene encoding it have been associated with distal hereditary motor neuropathy.