MONOCLONAL ANTI-WFDC3

Description_x000D_ General description_x000D_ This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. The encoded protein contains four WFDC domains. Most WFDC genes are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. Alternatively spliced transcript variants have been observed but their full-length nature has not been determined. (provided by RefSeq)_x000D_ Immunogen_x000D_ WFDC3 (AAH26014.2, 1 a.a. ~ 48 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ MDENCQAGEKCCKSGCGRFCVPPVLPPKLTMNPNWTVRSDSELEIPVP_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4