{{ isErrorSetToBasket === false ? 'Товар добавлен вкорзину' : 'Не удалось добавить товар в корзину'}}
Перейти в корзину
{{Object.keys(error)[0]}}:
{{Object.values(error)[0]}}
Цена По запросу
Количество
Вы уже добавили максимально доступное на складе кол-во товара
Достигнуто максимально доступное кол-во
Под заказ
{{!!storageProduct ? 'На складе' : 'Под заказ'}}
Ожидается поставка
Description; Immunogen; Synthetic peptide directed towards the N terminal region of human CEBPA; Application; Anti-CEBPA antibody produced in rabbit is suitable for western blotting at a concentration of 5 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; CCAAT/enhancer binding proteins are involved in the regulation of genes involved in the differentiation of squamous epithelial cells. They have been reported to exhibit altered expression in skin neoplasms. CEB proteins also mediate the functional interaction of IL-6 and TNF-α in mouse embryonic fibroblasts.; Sequence; Synthetic peptide located within the following region: GGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGG
- Properties Alphabetical Index Related Categories